SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5t6fb1 (5t6f B:1-173)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055629Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2055630Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2057856Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 protein domains)
  6. 2058054Protein automated matches [190384] (19 species)
    not a true protein
  7. 2270301Species Norwalk virus [TaxId:524364] [313606] (10 PDB entries)
  8. 2283198Domain d5t6fb1: 5t6f B:1-173 [326499]
    Other proteins in same PDB: d5t6fa2, d5t6fb2
    automated match to d2fyqa_
    complexed with n38

Details for d5t6fb1

PDB Entry: 5t6f (more details), 1.9 Å

PDB Description: 1.90 a resolution structure of norovirus 3cl protease in complex with the dipeptidyl inhibitor 7l (orthorhombic p form)
PDB Compounds: (B:) Genome polyprotein

SCOPe Domain Sequences for d5t6fb1:

Sequence, based on SEQRES records: (download)

>d5t6fb1 b.47.1.4 (B:1-173) automated matches {Norwalk virus [TaxId: 524364]}
apptlwsrvtkfgsgwgfwvsptvfittthvvptgvkeffgeplssiaihqageftqfrf
skkmrpdltgmvleegcpegtvcsvlikrdsgellplavrmgaiasmriqgrlvhgqsgm
lltganakgmdlgtipgdcgapyvhkrgndwvvcgvhaaatksgntvvcavqa

Sequence, based on observed residues (ATOM records): (download)

>d5t6fb1 b.47.1.4 (B:1-173) automated matches {Norwalk virus [TaxId: 524364]}
apptlwsrvtkfgsgwgfwvsptvfittthvvptgvkeffgeplssiaihqageftqfrf
skkmrpdltgmvleegcpegtvcsvlikrdsgellplavrmgaiasmriqgrlvhgqsgm
llgtipgdcgapyvhkrgndwvvcgvhaaatksgntvvcavqa

SCOPe Domain Coordinates for d5t6fb1:

Click to download the PDB-style file with coordinates for d5t6fb1.
(The format of our PDB-style files is described here.)

Timeline for d5t6fb1:

  • d5t6fb1 appears in periodic updates to SCOPe 2.06 starting on 2016-11-24

View in 3D
Domains from same chain:
(mouse over for more information)
d5t6fb2