SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5gljb_ (5glj B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2048292Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2048293Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2048294Family b.36.1.1: PDZ domain [50157] (47 protein domains)
    Pfam PF00595
  6. 2048590Protein automated matches [190055] (7 species)
    not a true protein
  7. 2283113Species Homo sapiens [TaxId:9606] [326414] (1 PDB entry)
  8. 2283196Domain d5gljb_: 5glj B: [326497]
    Other proteins in same PDB: d5glja2, d5gljc2, d5gljd2
    automated match to d2h3lb_
    complexed with cl

Details for d5gljb_

PDB Entry: 5glj (more details), 1.6 Å

PDB Description: crystal structure of pdz1 domain of human protein tyrosine phosphatase ptp-bas
PDB Compounds: (B:) Tyrosine-protein phosphatase non-receptor type 13

SCOPe Domain Sequences for d5gljb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gljb_ b.36.1.1 (B:) automated matches {Homo sapiens [TaxId: 9606]}
spereitlvnlkkdakyglgfqiiggekmgrldlgifissvapggpadldgclkpgdrli
svnsvslegvshhaaieilqnapedvtlvisqp

SCOPe Domain Coordinates for d5gljb_:

Click to download the PDB-style file with coordinates for d5gljb_.
(The format of our PDB-style files is described here.)

Timeline for d5gljb_:

  • d5gljb_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-24