Lineage for d2n9ga_ (2n9g A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2319937Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2319938Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2320170Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 2320171Protein automated matches [190615] (14 species)
    not a true protein
  7. 2321520Species Trypanosoma brucei [TaxId:185431] [326495] (1 PDB entry)
  8. 2321521Domain d2n9ga_: 2n9g A: [326496]
    automated match to d5c4qb_

Details for d2n9ga_

PDB Entry: 2n9g (more details)

PDB Description: solution structure of the bromodomain of trypanosoma brucei bromodomain factor 2(bdf2)
PDB Compounds: (A:) Putative uncharacterized protein

SCOPe Domain Sequences for d2n9ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2n9ga_ a.29.2.0 (A:) automated matches {Trypanosoma brucei [TaxId: 185431]}
msknerdtsfnkngclvfvsrlwdldklgmfhhpvsaeelpdyhtvikrpvdlssirdgi
ekgtyatdvdvqndvarmitnaleynakgstwyqeamsfrktyldlarqsg

SCOPe Domain Coordinates for d2n9ga_:

Click to download the PDB-style file with coordinates for d2n9ga_.
(The format of our PDB-style files is described here.)

Timeline for d2n9ga_: