Class a: All alpha proteins [46456] (289 folds) |
Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.2: Bromodomain [47370] (2 families) |
Family a.29.2.0: automated matches [191428] (1 protein) not a true family |
Protein automated matches [190615] (14 species) not a true protein |
Species Trypanosoma brucei [TaxId:185431] [326495] (1 PDB entry) |
Domain d2n9ga_: 2n9g A: [326496] automated match to d5c4qb_ |
PDB Entry: 2n9g (more details)
SCOPe Domain Sequences for d2n9ga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2n9ga_ a.29.2.0 (A:) automated matches {Trypanosoma brucei [TaxId: 185431]} msknerdtsfnkngclvfvsrlwdldklgmfhhpvsaeelpdyhtvikrpvdlssirdgi ekgtyatdvdvqndvarmitnaleynakgstwyqeamsfrktyldlarqsg
Timeline for d2n9ga_: