SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2n9ga_ (2n9g A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1992366Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1992367Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 1992467Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 1992468Protein automated matches [190615] (10 species)
    not a true protein
  7. 2283194Species Trypanosoma brucei [TaxId:185431] [326495] (1 PDB entry)
  8. 2283195Domain d2n9ga_: 2n9g A: [326496]
    automated match to d5c4qb_

Details for d2n9ga_

PDB Entry: 2n9g (more details)

PDB Description: solution structure of the bromodomain of trypanosoma brucei bromodomain factor 2(bdf2)
PDB Compounds: (A:) Putative uncharacterized protein

SCOPe Domain Sequences for d2n9ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2n9ga_ a.29.2.0 (A:) automated matches {Trypanosoma brucei [TaxId: 185431]}
msknerdtsfnkngclvfvsrlwdldklgmfhhpvsaeelpdyhtvikrpvdlssirdgi
ekgtyatdvdvqndvarmitnaleynakgstwyqeamsfrktyldlarqsg

SCOPe Domain Coordinates for d2n9ga_:

Click to download the PDB-style file with coordinates for d2n9ga_.
(The format of our PDB-style files is described here.)

Timeline for d2n9ga_:

  • d2n9ga_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-24