Lineage for d5ho6a_ (5ho6 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2979693Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2981716Protein Hepatocyte growth factor receptor, c-MET [103300] (1 species)
    PTK group; HGFR subfamily; membrane spanning protein tyrosine kinase
  7. 2981717Species Human (Homo sapiens) [TaxId:9606] [103301] (67 PDB entries)
  8. 2981777Domain d5ho6a_: 5ho6 A: [326492]
    automated match to d1r0pa_
    complexed with 63k

Details for d5ho6a_

PDB Entry: 5ho6 (more details), 1.97 Å

PDB Description: crystal structure of cmet in complex with cmpd.
PDB Compounds: (A:) Hepatocyte growth factor receptor

SCOPe Domain Sequences for d5ho6a_:

Sequence, based on SEQRES records: (download)

>d5ho6a_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]}
vqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkkihcavkslnritdigevs
qfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrnfirnethnptvkdli
gfglqvakgmkflaskkfvhrdlaarncmldekftvkvadfglardmydkefdsvhnktg
aklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypdvntfditvyllqgrrl
lqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfigehyvhvnaty

Sequence, based on observed residues (ATOM records): (download)

>d5ho6a_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]}
vqavqhvvigpcvyhgtlihcavksvsqfltegiimkdfshpnvlsllgicgsplvvlpy
mkhgdlrnfirnethnptvkdligfglqvakgmkflaskkfvhrdlaarncmldekftvk
vadfglarlpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypdvntfditvyl
lqgrrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfigehyvhvnaty

SCOPe Domain Coordinates for d5ho6a_:

Click to download the PDB-style file with coordinates for d5ho6a_.
(The format of our PDB-style files is described here.)

Timeline for d5ho6a_: