SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ho6a_ (5ho6 A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2195565Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2195566Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2195690Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 protein domains)
    members organized in the groups and subfamiles specified by the comments
  6. 2197126Protein Hepatocyte growth factor receptor, c-MET [103300] (1 species)
    PTK group; HGFR subfamily; membrane spanning protein tyrosine kinase
  7. 2197127Species Human (Homo sapiens) [TaxId:9606] [103301] (52 PDB entries)
  8. 2283191Domain d5ho6a_: 5ho6 A: [326492]
    automated match to d1r0pa_
    complexed with 63k

Details for d5ho6a_

PDB Entry: 5ho6 (more details), 1.97 Å

PDB Description: crystal structure of cmet in complex with cmpd.
PDB Compounds: (A:) Hepatocyte growth factor receptor

SCOPe Domain Sequences for d5ho6a_:

Sequence, based on SEQRES records: (download)

>d5ho6a_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]}
vqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkkihcavkslnritdigevs
qfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrnfirnethnptvkdli
gfglqvakgmkflaskkfvhrdlaarncmldekftvkvadfglardmydkefdsvhnktg
aklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypdvntfditvyllqgrrl
lqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfigehyvhvnaty

Sequence, based on observed residues (ATOM records): (download)

>d5ho6a_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]}
vqavqhvvigpcvyhgtlihcavksvsqfltegiimkdfshpnvlsllgicgsplvvlpy
mkhgdlrnfirnethnptvkdligfglqvakgmkflaskkfvhrdlaarncmldekftvk
vadfglarlpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypdvntfditvyl
lqgrrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfigehyvhvnaty

SCOPe Domain Coordinates for d5ho6a_:

Click to download the PDB-style file with coordinates for d5ho6a_.
(The format of our PDB-style files is described here.)

Timeline for d5ho6a_:

  • d5ho6a_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-24