SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5hyka_ (5hyk A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2008932Protein Peroxisome proliferator activated receptor alpha, PPAR-alpha [69109] (1 species)
  7. 2008933Species Human (Homo sapiens) [TaxId:9606] [69110] (16 PDB entries)
  8. 2283185Domain d5hyka_: 5hyk A: [326486]
    automated match to d3kdua_
    complexed with 65w

Details for d5hyka_

PDB Entry: 5hyk (more details), 1.83 Å

PDB Description: crystal structure of the complex pparalpha/al26-29
PDB Compounds: (A:) Peroxisome proliferator-activated receptor alpha

SCOPe Domain Sequences for d5hyka_:

Sequence, based on SEQRES records: (download)

>d5hyka_ a.123.1.1 (A:) Peroxisome proliferator activated receptor alpha, PPAR-alpha {Human (Homo sapiens) [TaxId: 9606]}
dlkslakriyeaylknfnmnkvkarvilsgkasnnppfvihdmetlcmaektlvaklvan
giqnkeaevrifhccqctsvetvteltefakaipgfanldlndqvtllkygvyeaifaml
ssvmnkdgmlvaygngfitreflkslrkpfcdimepkfdfamkfnalelddsdislfvaa
iiccgdrpgllnvghiekmqegivhvlrlhlqsnhpddiflfpkllqkmadlrqlvteha
qlvqiikktesdaalhpllqeiyrdmy

Sequence, based on observed residues (ATOM records): (download)

>d5hyka_ a.123.1.1 (A:) Peroxisome proliferator activated receptor alpha, PPAR-alpha {Human (Homo sapiens) [TaxId: 9606]}
dlkslakriyeaylknfnmnkvkarvilspfvihdmetlcmaektlvaklvnkeaevrif
hccqctsvetvteltefakaipgfanldlndqvtllkygvyeaifamlssvmnkdgmlva
ygngfitreflkslrkpfcdimepkfdfamkfnalelddsdislfvaaiiccgdrpglln
vghiekmqegivhvlrlhlqsnhpddiflfpkllqkmadlrqlvtehaqlvqiikktesd
aalhpllqeiyrdmy

SCOPe Domain Coordinates for d5hyka_:

Click to download the PDB-style file with coordinates for d5hyka_.
(The format of our PDB-style files is described here.)

Timeline for d5hyka_:

  • d5hyka_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-23