Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) has additional strand at N-terminus |
Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins) |
Protein Cu,Zn superoxide dismutase, SOD [49331] (16 species) |
Species Human (Homo sapiens) [TaxId:9606] [49333] (79 PDB entries) |
Domain d5k02o_: 5k02 O: [326485] automated match to d2c9va_ complexed with cu, zn; mutant |
PDB Entry: 5k02 (more details), 1.99 Å
SCOPe Domain Sequences for d5k02o_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5k02o_ b.1.8.1 (O:) Cu,Zn superoxide dismutase, SOD {Human (Homo sapiens) [TaxId: 9606]} adkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvh ekaddlgkggneestktgnagsrlacgvigiaq
Timeline for d5k02o_: