SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5hs2a_ (5hs2 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2133075Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2133076Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2133953Family c.68.1.0: automated matches [191551] (1 protein)
    not a true family
  6. 2133954Protein automated matches [190951] (24 species)
    not a true protein
  7. 2278577Species Bacillus subtilis [TaxId:224308] [321878] (3 PDB entries)
  8. 2283182Domain d5hs2a_: 5hs2 A: [326483]
    automated match to d4naka_
    complexed with ctp, mg

Details for d5hs2a_

PDB Entry: 5hs2 (more details), 1.9 Å

PDB Description: crystal structure of ispd complexed with ctp and mg2+ from bacillus subtilis at 1.90 angstroms resolution
PDB Compounds: (A:) 2-c-methyl-d-erythritol 4-phosphate cytidylyltransferase

SCOPe Domain Sequences for d5hs2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hs2a_ c.68.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 224308]}
msydvvipaagqgkrmkagrnklfielkgdpviihtlrvfdshrqcdkiilvineqereh
fqqllsdypfqtsielvaggderqhsvykglkavkqekivlvhdgarpfikheqidelia
eaeqtgaailavpvkdtikrvqdlqvsetiersslwavqtpqafrlsllmkahaeaerkg
flgtddaslveqmeggsvrvvegsytniklttpddltsaeaimese

SCOPe Domain Coordinates for d5hs2a_:

Click to download the PDB-style file with coordinates for d5hs2a_.
(The format of our PDB-style files is described here.)

Timeline for d5hs2a_:

  • d5hs2a_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-23