SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5enga_ (5eng A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1992366Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1992367Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 1992368Family a.29.2.1: Bromodomain [47371] (5 protein domains)
  6. 1992403Protein automated matches [190366] (1 species)
    not a true protein
  7. 1992404Species Human (Homo sapiens) [TaxId:9606] [187201] (50 PDB entries)
  8. 2283179Domain d5enga_: 5eng A: [326480]
    automated match to d4nyva_
    complexed with 5qn

Details for d5enga_

PDB Entry: 5eng (more details), 1.3 Å

PDB Description: crystal structure of the bromodomain of human crebbp in complex with up39
PDB Compounds: (A:) creb-binding protein

SCOPe Domain Sequences for d5enga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5enga_ a.29.2.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlstikrkl
dtgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqsl

SCOPe Domain Coordinates for d5enga_:

Click to download the PDB-style file with coordinates for d5enga_.
(The format of our PDB-style files is described here.)

Timeline for d5enga_:

  • d5enga_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-23