SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5k9sa_ (5k9s A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2006337Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2006908Family a.118.1.0: automated matches [191340] (1 protein)
    not a true family
  6. 2006909Protein automated matches [190220] (14 species)
    not a true protein
  7. 2006978Species Mouse (Mus musculus) [TaxId:10090] [272712] (5 PDB entries)
  8. 2283175Domain d5k9sa_: 5k9s A: [326476]
    automated match to d1un0b_

Details for d5k9sa_

PDB Entry: 5k9s (more details), 2.4 Å

PDB Description: importin-alpha in complex with hnf1-beta peptide
PDB Compounds: (A:) Importin subunit alpha-1

SCOPe Domain Sequences for d5k9sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5k9sa_ a.118.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vnwsvedivkginsnnlesqlqatqaarkllsrekqppidniiraglipkfvsflgktdc
spiqfesawaltniasgtseqtkavvdggaipafisllasphahiseqavwalgniagdg
safrdlvikhgaidpllallavpdlstlacgylrnltwtlsnlcrnknpappldaveqil
ptlvrllhhndpevladscwaisyltdgpneriemvvkkgvvpqlvkllgatelpivtpa
lraignivtgtdeqtqkvidagalavfpslltnpktniqkeatwtmsnitagrqdqiqqv
vnhglvpflvgvlskadfktqkeaawaitnytsggtveqivylvhcgiieplmnllsakd
tkiiqvildaisnifqaaeklgeteklsimieecggldkiealqrhenesvykaslnlie
kyfsv

SCOPe Domain Coordinates for d5k9sa_:

Click to download the PDB-style file with coordinates for d5k9sa_.
(The format of our PDB-style files is described here.)

Timeline for d5k9sa_:

  • d5k9sa_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-23