Lineage for d5k9sa_ (5k9s A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2006337Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2006908Family a.118.1.0: automated matches [191340] (1 protein)
    not a true family
  6. 2006909Protein automated matches [190220] (14 species)
    not a true protein
  7. 2006978Species Mouse (Mus musculus) [TaxId:10090] [272712] (5 PDB entries)
  8. 2283175Domain d5k9sa_: 5k9s A: [326476]
    automated match to d1un0b_

Details for d5k9sa_

PDB Entry: 5k9s (more details), 2.4 Å

PDB Description: importin-alpha in complex with hnf1-beta peptide
PDB Compounds: (A:) Importin subunit alpha-1

SCOPe Domain Sequences for d5k9sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5k9sa_ a.118.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vnwsvedivkginsnnlesqlqatqaarkllsrekqppidniiraglipkfvsflgktdc
spiqfesawaltniasgtseqtkavvdggaipafisllasphahiseqavwalgniagdg
safrdlvikhgaidpllallavpdlstlacgylrnltwtlsnlcrnknpappldaveqil
ptlvrllhhndpevladscwaisyltdgpneriemvvkkgvvpqlvkllgatelpivtpa
lraignivtgtdeqtqkvidagalavfpslltnpktniqkeatwtmsnitagrqdqiqqv
vnhglvpflvgvlskadfktqkeaawaitnytsggtveqivylvhcgiieplmnllsakd
tkiiqvildaisnifqaaeklgeteklsimieecggldkiealqrhenesvykaslnlie
kyfsv

SCOPe Domain Coordinates for d5k9sa_:

Click to download the PDB-style file with coordinates for d5k9sa_.
(The format of our PDB-style files is described here.)

Timeline for d5k9sa_:

  • d5k9sa_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-23