SCOPe 2.08: Domain d5fjta2: 5fjt A:126-367

Lineage for d5fjta2 (5fjt A:126-367)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.2: D-glucarate dehydratase-like [51609] (15 proteins)

6. Protein automated matches [226997] (13 species)
   not a true protein

7. Species Amycolatopsis sp. [TaxId:37632] [326207] (5 PDB entries)

8. Domain d5fjta2: 5fjt A:126-367 [326475]
   Other proteins in same PDB: d5fjta1, d5fjtb1, d5fjtc1, d5fjtd1
   automated match to d1sjdb1
   complexed with 5cr, mg; mutant

Details for d5fjta2

PDB Entry: 5fjt, 2.11 Å

PDB Description: n-acyl amino acid racemase from amycolatopsis sp. ts-1-60: g291d f323 mutant in complex with n-acetyl phenylalanine

PDB Compounds: (A:) o-succinylbenzoate synthase

SCOPe Domain Sequences for d5fjta2:

Sequence; same for both SEQRES and ATOM records:

>d5fjta2 c.1.11.2 (A:126-367) automated matches {Amycolatopsis sp. [TaxId: 37632]}
vrdsvpcgvsvgimdtipqlldvvggyldegyvriklkiepgwdvepvravrerfgddvl
lqvdantaytlgdapqlarldpfglllieqpleeedvlghaelarriqtpicldesivsa
raaadaiklgavqivnikpgrvggylearrvhdvcaahgipvwcgdmietglgraanval
aslpnftlpgdtsasdryyktditepfvlsgghlpvptgpglgvapipelldevttakvw
ig

Timeline for d5fjta2:

• d5fjta2 first appeared in SCOPe 2.06
  
• d5fjta2 appears in SCOPe 2.07