Lineage for d5hlwa_ (5hlw A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2195565Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2195566Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2195690Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 protein domains)
    members organized in the groups and subfamiles specified by the comments
  6. 2197126Protein Hepatocyte growth factor receptor, c-MET [103300] (1 species)
    PTK group; HGFR subfamily; membrane spanning protein tyrosine kinase
  7. 2197127Species Human (Homo sapiens) [TaxId:9606] [103301] (52 PDB entries)
  8. 2283172Domain d5hlwa_: 5hlw A: [326473]
    automated match to d3f82a_
    complexed with 62e, cl; mutant

Details for d5hlwa_

PDB Entry: 5hlw (more details), 1.97 Å

PDB Description: crystal structure of c-met mutant y1230h in complex with compound 14
PDB Compounds: (A:) Hepatocyte growth factor receptor

SCOPe Domain Sequences for d5hlwa_:

Sequence, based on SEQRES records: (download)

>d5hlwa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]}
alnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkkihcavkslnrit
digevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrnfirnethnp
tvkdligfglqvakgmkylaskkfvhrdlaarncmldekftvkvadfglardmhdkeyys
vhnktgaklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypdvntfditvyl
lqgrrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfigehyvhvnat

Sequence, based on observed residues (ATOM records): (download)

>d5hlwa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]}
alnpelvqavqhvvigsslivhfnevigrhfgcvyhgtlldgkkihcavkslnridigev
sqfltegiimkdfshpnvlsllgicsplvvlpymkhgdlrnfirnethnptvkdligfgl
qvakgmkylaskkfvhrdlaarncmldekftvkvadfglardmhdkeyysvaklpvkwma
leslqtqkfttksdvwsfgvllwelmtrgappypdvntfditvyllqgrrllqpeycpdp
lyevmlkcwhpkaemrpsfselvsrisaifstfigehyvhvnat

SCOPe Domain Coordinates for d5hlwa_:

Click to download the PDB-style file with coordinates for d5hlwa_.
(The format of our PDB-style files is described here.)

Timeline for d5hlwa_:

  • d5hlwa_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-23