Lineage for d5ft8o_ (5ft8 O:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2132229Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2132230Protein automated matches [190151] (119 species)
    not a true protein
  7. 2132475Species Escherichia coli K-12 [TaxId:83333] [226746] (6 PDB entries)
  8. 2283168Domain d5ft8o_: 5ft8 O: [326469]
    Other proteins in same PDB: d5ft8b1, d5ft8b2, d5ft8d1, d5ft8d2, d5ft8f_, d5ft8h1, d5ft8h2, d5ft8j_, d5ft8l_, d5ft8n_
    automated match to d4lw2a_
    complexed with css, gol, peg, plp

Details for d5ft8o_

PDB Entry: 5ft8 (more details), 2.5 Å

PDB Description: structure of a cysteine desulfurase-sulfur acceptor complex from escherichia coli at 2.50 angstroem resolution
PDB Compounds: (O:) cysteine desulfurase csda

SCOPe Domain Sequences for d5ft8o_:

Sequence, based on SEQRES records: (download)

>d5ft8o_ c.67.1.0 (O:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
vfnpaqfraqfpalqdagvyldsaatalkpeavveatqqfyslsagnvhrsqfaeaqrlt
aryeaarekvaqllnapddktivwtrgttesinmvaqcyarprlqpgdeiivsvaehhan
lvpwlmvaqqtgakvvklplnaqrlpdvdllpelitprsrilalgqmsnvtggcpdlara
itfahsagmvvmvdgaqgavhfpadvqqldidfyafsghklygptgigvlygkselleam
spwlgggkmvhevsfdgfttqsapwkleagtpnvagviglsaalewladydinqaeswsr
slatlaedalakrpgfrsfrcqdssllafdfagvhhsdmvtllaeygialragqhcaqpl
laelgvtgtlrasfapyntksdvdalvnavdralellvd

Sequence, based on observed residues (ATOM records): (download)

>d5ft8o_ c.67.1.0 (O:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
vfnpaqfraqfpalqdagvyldsaatalkpeavveatqqfyslsagnvhrsqfaeaqrlt
aryeaarekvaqllnapddktivwtrgttesinmvaqcyarprlqpgdeiivsvaehhan
lvpwlmvaqqtgakvvklplnaqrlpdvdllpelitprsrilalgqmsnvtggcpdlara
itfahsagmvvmvdgaqgavhfpadvqqldidfyafsghklygptgigvlygkselleam
spwlgggkmvhevsfdgfttqsapwkleagtpnvagviglsaalewladydinqaeswsr
slatlaedalakrpgfrsfrcqdssllafdfagvhhsdmvtllaeygialragqhaqpll
aelgvtgtlrasfapyntksdvdalvnavdralellvd

SCOPe Domain Coordinates for d5ft8o_:

Click to download the PDB-style file with coordinates for d5ft8o_.
(The format of our PDB-style files is described here.)

Timeline for d5ft8o_:

  • d5ft8o_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-24