Lineage for d5fjga1 (5fjg A:1-266)

  1. Root: SCOPe 2.06
  2. 2223823Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2225114Fold f.13: Class A G protein-coupled receptor (GPCR)-like [81322] (1 superfamily)
    core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane
  4. 2225115Superfamily f.13.1: Class A G protein-coupled receptor (GPCR)-like [81321] (5 families) (S)
    Pfam PF13853. Phylogeny described in PubMed 12761335
  5. 2225357Family f.13.1.0: automated matches [227143] (1 protein)
    not a true family
  6. 2225358Protein automated matches [226845] (15 species)
    not a true protein
  7. 2276222Species Nonlabens marinus [TaxId:1454201] [319523] (7 PDB entries)
  8. 2283164Domain d5fjga1: 5fjg A:1-266 [326465]
    Other proteins in same PDB: d5fjga2
    automated match to d5azdc_
    complexed with anr, cl, ola

Details for d5fjga1

PDB Entry: 5fjg (more details), 2 Å

PDB Description: the crystal structure of light-driven chloride pump clr in ph 4.5.
PDB Compounds: (A:) Chloride pumping rhodopsin

SCOPe Domain Sequences for d5fjga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fjga1 f.13.1.0 (A:1-266) automated matches {Nonlabens marinus [TaxId: 1454201]}
mknieslfdysagqfefidhlltmgvgvhfaalifflvvsqfvapkyriatalscivmvs
aglilnsqavmwtdayayvdgsyqlqdltfsngyryvnwmatipclllqllivlnlkgke
lfstatwlilaawgmiitgyvgqlyevddiaqlmiwgavstaffvvmnwivgtkifknra
tmlggtdstitkvfwlmmfawtlypiaylvpafmnnadgvvlrqllftiadisskviygl
mityiaiqqsaaagyvpaqqalgrig

SCOPe Domain Coordinates for d5fjga1:

Click to download the PDB-style file with coordinates for d5fjga1.
(The format of our PDB-style files is described here.)

Timeline for d5fjga1:

  • d5fjga1 appears in periodic updates to SCOPe 2.06 starting on 2016-11-23

View in 3D
Domains from same chain:
(mouse over for more information)
d5fjga2