SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5fjga1 (5fjg A:1-266)

  1. Root: SCOPe 2.06
  2. 2223823Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2225114Fold f.13: Class A G protein-coupled receptor (GPCR)-like [81322] (1 superfamily)
    core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane
  4. 2225115Superfamily f.13.1: Class A G protein-coupled receptor (GPCR)-like [81321] (5 families) (S)
    Pfam PF13853. Phylogeny described in PubMed 12761335
  5. 2225357Family f.13.1.0: automated matches [227143] (1 protein)
    not a true family
  6. 2225358Protein automated matches [226845] (15 species)
    not a true protein
  7. 2276222Species Nonlabens marinus [TaxId:1454201] [319523] (7 PDB entries)
  8. 2283164Domain d5fjga1: 5fjg A:1-266 [326465]
    Other proteins in same PDB: d5fjga2
    automated match to d5azdc_
    complexed with anr, cl, ola

Details for d5fjga1

PDB Entry: 5fjg (more details), 2 Å

PDB Description: the crystal structure of light-driven chloride pump clr in ph 4.5.
PDB Compounds: (A:) Chloride pumping rhodopsin

SCOPe Domain Sequences for d5fjga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fjga1 f.13.1.0 (A:1-266) automated matches {Nonlabens marinus [TaxId: 1454201]}
mknieslfdysagqfefidhlltmgvgvhfaalifflvvsqfvapkyriatalscivmvs
aglilnsqavmwtdayayvdgsyqlqdltfsngyryvnwmatipclllqllivlnlkgke
lfstatwlilaawgmiitgyvgqlyevddiaqlmiwgavstaffvvmnwivgtkifknra
tmlggtdstitkvfwlmmfawtlypiaylvpafmnnadgvvlrqllftiadisskviygl
mityiaiqqsaaagyvpaqqalgrig

SCOPe Domain Coordinates for d5fjga1:

Click to download the PDB-style file with coordinates for d5fjga1.
(The format of our PDB-style files is described here.)

Timeline for d5fjga1:

  • d5fjga1 appears in periodic updates to SCOPe 2.06 starting on 2016-11-23

View in 3D
Domains from same chain:
(mouse over for more information)
d5fjga2