SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5k02k_ (5k02 K:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2031006Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) (S)
    has additional strand at N-terminus
  5. 2031007Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 protein domains)
  6. 2031020Protein Cu,Zn superoxide dismutase, SOD [49331] (16 species)
  7. 2031123Species Human (Homo sapiens) [TaxId:9606] [49333] (78 PDB entries)
  8. 2283162Domain d5k02k_: 5k02 K: [326463]
    automated match to d2c9va_
    complexed with cu, zn; mutant

Details for d5k02k_

PDB Entry: 5k02 (more details), 1.99 Å

PDB Description: structure of human sod1 with t2d mutation
PDB Compounds: (K:) Superoxide dismutase [Cu-Zn]

SCOPe Domain Sequences for d5k02k_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5k02k_ b.1.8.1 (K:) Cu,Zn superoxide dismutase, SOD {Human (Homo sapiens) [TaxId: 9606]}
adkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvh
ekaddlgkggneestktgnagsrlacgvigiaq

SCOPe Domain Coordinates for d5k02k_:

Click to download the PDB-style file with coordinates for d5k02k_.
(The format of our PDB-style files is described here.)

Timeline for d5k02k_:

  • d5k02k_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-23