SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5eu9f2 (5eu9 F:141-434)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2086988Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2086989Family c.1.11.1: Enolase [51605] (2 protein domains)
    automatically mapped to Pfam PF00113
  6. 2086990Protein Enolase [51606] (10 species)
    Fold of this protein slightly differs from common fold in topology
  7. 2087034Species Human (Homo sapiens), gamma isoform [TaxId:9606] [110371] (13 PDB entries)
    Uniprot P09104
  8. 2283159Domain d5eu9f2: 5eu9 F:141-434 [326460]
    Other proteins in same PDB: d5eu9a1, d5eu9b1, d5eu9c1, d5eu9c3, d5eu9d1, d5eu9e1, d5eu9f1, d5eu9f3, d5eu9g1, d5eu9h1
    automated match to d2akza1
    complexed with 5tx, mg, pge

Details for d5eu9f2

PDB Entry: 5eu9 (more details), 2.05 Å

PDB Description: structure of human enolase 2 in complex with ((3s,5s)-1,5-dihydroxy-3- methyl-2-oxopyrrolidin-3-yl)phosphonic acid
PDB Compounds: (F:) Gamma-enolase

SCOPe Domain Sequences for d5eu9f2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5eu9f2 c.1.11.1 (F:141-434) Enolase {Human (Homo sapiens), gamma isoform [TaxId: 9606]}
sdlilpvpafnvinggshagnklamqefmilpvgaesfrdamrlgaevyhtlkgvikdky
gkdatnvgdeggfapnilensealelvkeaidkagytekivigmdvaasefyrdgkydld
fksptdpsryitgdqlgalyqdfvrdypvvsiedpfdqddwaawskftanvgiqivgddl
tvtnpkrieraveekacnclllkvnqigsvteaiqacklaqengwgvmvshrsgetedtf
iadlvvglctgqiktgapcrserlakynqlmrieeelgdearfaghnfrnpsvl

SCOPe Domain Coordinates for d5eu9f2:

Click to download the PDB-style file with coordinates for d5eu9f2.
(The format of our PDB-style files is described here.)

Timeline for d5eu9f2:

  • d5eu9f2 appears in periodic updates to SCOPe 2.06 starting on 2016-11-24