Lineage for d5eu9f2 (5eu9 F:141-434)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2836768Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2836769Family c.1.11.1: Enolase [51605] (2 proteins)
    automatically mapped to Pfam PF00113
  6. 2836770Protein Enolase [51606] (11 species)
    Fold of this protein slightly differs from common fold in topology
  7. 2836820Species Human (Homo sapiens), gamma isoform [TaxId:9606] [110371] (15 PDB entries)
    Uniprot P09104
  8. 2836844Domain d5eu9f2: 5eu9 F:141-434 [326460]
    Other proteins in same PDB: d5eu9a1, d5eu9b1, d5eu9c1, d5eu9c3, d5eu9d1, d5eu9e1, d5eu9f1, d5eu9f3, d5eu9g1, d5eu9h1
    automated match to d2akza1
    complexed with 5tx, mg, pge

Details for d5eu9f2

PDB Entry: 5eu9 (more details), 2.05 Å

PDB Description: structure of human enolase 2 in complex with ((3s,5s)-1,5-dihydroxy-3- methyl-2-oxopyrrolidin-3-yl)phosphonic acid
PDB Compounds: (F:) Gamma-enolase

SCOPe Domain Sequences for d5eu9f2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5eu9f2 c.1.11.1 (F:141-434) Enolase {Human (Homo sapiens), gamma isoform [TaxId: 9606]}
sdlilpvpafnvinggshagnklamqefmilpvgaesfrdamrlgaevyhtlkgvikdky
gkdatnvgdeggfapnilensealelvkeaidkagytekivigmdvaasefyrdgkydld
fksptdpsryitgdqlgalyqdfvrdypvvsiedpfdqddwaawskftanvgiqivgddl
tvtnpkrieraveekacnclllkvnqigsvteaiqacklaqengwgvmvshrsgetedtf
iadlvvglctgqiktgapcrserlakynqlmrieeelgdearfaghnfrnpsvl

SCOPe Domain Coordinates for d5eu9f2:

Click to download the PDB-style file with coordinates for d5eu9f2.
(The format of our PDB-style files is described here.)

Timeline for d5eu9f2: