Lineage for d1d1pa_ (1d1p A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2874827Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (3 superfamilies)
    3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134
  4. 2874828Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (2 families) (S)
    share the common active site structure with the family II
  5. 2874829Family c.44.1.1: Low-molecular-weight phosphotyrosine protein phosphatases [52789] (3 proteins)
    automatically mapped to Pfam PF01451
  6. 2874853Protein Tyrosine phosphatase [52790] (5 species)
  7. 2874854Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52793] (3 PDB entries)
  8. 2874859Domain d1d1pa_: 1d1p A: [32646]
    complexed with epe

Details for d1d1pa_

PDB Entry: 1d1p (more details), 2.2 Å

PDB Description: crystal structure of a yeast low molecular weight protein tyrosine phosphatase (ltp1)
PDB Compounds: (A:) tyrosine phosphatase

SCOPe Domain Sequences for d1d1pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d1pa_ c.44.1.1 (A:) Tyrosine phosphatase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pkisvaficlgnfcrspmaeaifkhevekanlenrfnkidsfgtsnyhvgespdhrtvsi
ckqhgvkinhkgkqiktkhfdeydyiigmdesninnlkkiqpegskakvclfgdwntndg
tvqtiiedpwygdiqdfeynfkqityfskqflkkel

SCOPe Domain Coordinates for d1d1pa_:

Click to download the PDB-style file with coordinates for d1d1pa_.
(The format of our PDB-style files is described here.)

Timeline for d1d1pa_: