Lineage for d5h02a_ (5h02 A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2145089Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2145090Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2146607Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2146608Protein automated matches [190689] (64 species)
    not a true protein
  7. 2146851Species Methanohalophilus portucalensis [TaxId:523843] [326452] (1 PDB entry)
  8. 2146852Domain d5h02a_: 5h02 A: [326453]
    automated match to d2azta_
    complexed with bet, sah; mutant

Details for d5h02a_

PDB Entry: 5h02 (more details), 1.78 Å

PDB Description: crystal structure of methanohalophilus portucalensis glycine sarcosine n-methyltransferase tetramutant (h21g, e23t, e24n, l28s)
PDB Compounds: (A:) Glycine sarcosine N-methyltransferase

SCOPe Domain Sequences for d5h02a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h02a_ c.66.1.0 (A:) automated matches {Methanohalophilus portucalensis [TaxId: 523843]}
npievresdgytneyvsgfvdkwdelidwesraesegdtiinilkergvkkvldvatgtg
fnsvrllqagfdvvsadgsaemlvkafdnardhgylmrtvqadwrwmnkdihdkfdaivc
lgnsfthlfdegdrrkalaefyallkhdgvllldqrnydailddgysskhahyycgdtvs
vypehvdeglarfkyefsdgsvynlnmfplrkdytrqllhevgfqeintlgdfketyked
epdfflhvaekn

SCOPe Domain Coordinates for d5h02a_:

Click to download the PDB-style file with coordinates for d5h02a_.
(The format of our PDB-style files is described here.)

Timeline for d5h02a_: