Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) |
Family c.66.1.0: automated matches [191451] (1 protein) not a true family |
Protein automated matches [190689] (64 species) not a true protein |
Species Methanohalophilus portucalensis [TaxId:523843] [326452] (1 PDB entry) |
Domain d5h02a_: 5h02 A: [326453] automated match to d2azta_ complexed with bet, sah; mutant |
PDB Entry: 5h02 (more details), 1.78 Å
SCOPe Domain Sequences for d5h02a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5h02a_ c.66.1.0 (A:) automated matches {Methanohalophilus portucalensis [TaxId: 523843]} npievresdgytneyvsgfvdkwdelidwesraesegdtiinilkergvkkvldvatgtg fnsvrllqagfdvvsadgsaemlvkafdnardhgylmrtvqadwrwmnkdihdkfdaivc lgnsfthlfdegdrrkalaefyallkhdgvllldqrnydailddgysskhahyycgdtvs vypehvdeglarfkyefsdgsvynlnmfplrkdytrqllhevgfqeintlgdfketyked epdfflhvaekn
Timeline for d5h02a_: