SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5h02a_ (5h02 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2130608Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2130609Protein automated matches [190689] (60 species)
    not a true protein
  7. 2283151Species Methanohalophilus portucalensis [TaxId:523843] [326452] (1 PDB entry)
  8. 2283152Domain d5h02a_: 5h02 A: [326453]
    automated match to d2azta_
    complexed with bet, sah; mutant

Details for d5h02a_

PDB Entry: 5h02 (more details), 1.78 Å

PDB Description: crystal structure of methanohalophilus portucalensis glycine sarcosine n-methyltransferase tetramutant (h21g, e23t, e24n, l28s)
PDB Compounds: (A:) Glycine sarcosine N-methyltransferase

SCOPe Domain Sequences for d5h02a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h02a_ c.66.1.0 (A:) automated matches {Methanohalophilus portucalensis [TaxId: 523843]}
npievresdgytneyvsgfvdkwdelidwesraesegdtiinilkergvkkvldvatgtg
fnsvrllqagfdvvsadgsaemlvkafdnardhgylmrtvqadwrwmnkdihdkfdaivc
lgnsfthlfdegdrrkalaefyallkhdgvllldqrnydailddgysskhahyycgdtvs
vypehvdeglarfkyefsdgsvynlnmfplrkdytrqllhevgfqeintlgdfketyked
epdfflhvaekn

SCOPe Domain Coordinates for d5h02a_:

Click to download the PDB-style file with coordinates for d5h02a_.
(The format of our PDB-style files is described here.)

Timeline for d5h02a_:

  • d5h02a_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-23