Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.120: PIN domain-like [88722] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.120.1: PIN domain-like [88723] (3 families) |
Family c.120.1.1: PIN domain [89619] (7 proteins) Pfam PF01850 |
Protein Hypothetical protein PH0500 [142112] (2 species) |
Species Pyrococcus horikoshii [TaxId:70601] [326423] (2 PDB entries) |
Domain d5h4hb_: 5h4h B: [326448] automated match to d1v96a1 complexed with cd |
PDB Entry: 5h4h (more details), 2.23 Å
SCOPe Domain Sequences for d5h4hb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5h4hb_ c.120.1.1 (B:) Hypothetical protein PH0500 {Pyrococcus horikoshii [TaxId: 70601]} plppditfdslalikmhsqnmkrilevtlakftvnlsivtvyryltaraylkknieaefe ilkdiynivpllddiaikaaqieanlikkeitldmediitattaiytnsllvtddpkrye pirrfgldtmpldkfikevelmvek
Timeline for d5h4hb_: