SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5fnfa_ (5fnf A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2190933Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2190934Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2190935Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 protein domains)
  6. 2190936Protein HSP90 [55876] (3 species)
  7. 2191016Species Human (Homo sapiens) [TaxId:9606] [55878] (88 PDB entries)
    Uniprot P08238 10-220 # HSP 90-beta isoform ! Uniprot P07900 16-223
  8. 2283142Domain d5fnfa_: 5fnf A: [326443]
    automated match to d1uy7a_
    complexed with so4, tql

Details for d5fnfa_

PDB Entry: 5fnf (more details), 2.1 Å

PDB Description: dynamic undocking and the quasi-bound state as tools for drug design
PDB Compounds: (A:) heat shock protein, hsp90-alpha

SCOPe Domain Sequences for d5fnfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fnfa_ d.122.1.1 (A:) HSP90 {Human (Homo sapiens) [TaxId: 9606]}
evetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdpskldsgke
lhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadismigqfg
vgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlkedqt
eyleerrikeivkkhsqfigypitlfvek

SCOPe Domain Coordinates for d5fnfa_:

Click to download the PDB-style file with coordinates for d5fnfa_.
(The format of our PDB-style files is described here.)

Timeline for d5fnfa_:

  • d5fnfa_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-23