Lineage for d5fnfa_ (5fnf A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2190933Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2190934Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2190935Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 protein domains)
  6. 2190936Protein HSP90 [55876] (3 species)
  7. 2191016Species Human (Homo sapiens) [TaxId:9606] [55878] (93 PDB entries)
    Uniprot P08238 10-220 # HSP 90-beta isoform ! Uniprot P07900 16-223
  8. 2283142Domain d5fnfa_: 5fnf A: [326443]
    automated match to d1uy7a_
    complexed with so4, tql

Details for d5fnfa_

PDB Entry: 5fnf (more details), 2.1 Å

PDB Description: dynamic undocking and the quasi-bound state as tools for drug design
PDB Compounds: (A:) heat shock protein, hsp90-alpha

SCOPe Domain Sequences for d5fnfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fnfa_ d.122.1.1 (A:) HSP90 {Human (Homo sapiens) [TaxId: 9606]}
evetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdpskldsgke
lhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadismigqfg
vgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlkedqt
eyleerrikeivkkhsqfigypitlfvek

SCOPe Domain Coordinates for d5fnfa_:

Click to download the PDB-style file with coordinates for d5fnfa_.
(The format of our PDB-style files is described here.)

Timeline for d5fnfa_:

  • d5fnfa_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-23