Lineage for d5et8a_ (5et8 A:)

  1. Root: SCOPe 2.06
  2. 2217451Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2219721Fold e.7: Carbohydrate phosphatase [56654] (1 superfamily)
    N-terminal domain is an alpha+beta, C-terminal domain is an alpha/beta with mixed beta-sheet
  4. 2219722Superfamily e.7.1: Carbohydrate phosphatase [56655] (3 families) (S)
  5. 2219723Family e.7.1.1: Inositol monophosphatase/fructose-1,6-bisphosphatase-like [56656] (7 protein domains)
  6. 2219929Protein automated matches [190281] (5 species)
    not a true protein
  7. 2219933Species Human (Homo sapiens) [TaxId:9606] [187709] (25 PDB entries)
  8. 2283140Domain d5et8a_: 5et8 A: [326441]
    automated match to d1fsaa_
    complexed with f6p

Details for d5et8a_

PDB Entry: 5et8 (more details), 1.92 Å

PDB Description: human muscle fructose-1,6-bisphosphatase in active r-state in complex with fructose-6-phosphate
PDB Compounds: (A:) Fructose-1,6-bisphosphatase isozyme 2

SCOPe Domain Sequences for d5et8a_:

Sequence, based on SEQRES records: (download)

>d5et8a_ e.7.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dmltltryvmekgrqakgtgeltqllnsmltaikaissavrkaglahlygiagsvnvtgd
evkkldvlsnslvinmlqssystcvlvseenkdaiitakekrgkyvvcfdpldgssnidc
lasigtifaiyrktsedepsekdalqcgrnivaagyalygsatlvalstgqgvdlfmldp
algefvlvekdvkikkkgkiyslnegyakyfdaatteyvqkkkfpedgsapygaryvgsm
vadvhrtlvyggiflypanqkspkgklrllyecnpvayiieqagglattgtqpvldvkpe
aihqrvplilgspedvqeyltcvqkn

Sequence, based on observed residues (ATOM records): (download)

>d5et8a_ e.7.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dmltltryvmgeltqllnsmltaikaissavrkavkkldvlsnslvinmlqssystcvlv
seenkdaiitakekrgkyvvcfdpldgasigtifaiyrkpsekdalqcgrnivaagyaly
gsatlvalstgqgvdlfmldpalgefvlvekdvkikkkgkiyslnegyakyfdaatteyv
qkkkfpedgsapygaryvgsmvadvhrtlvyggiflypanqkspkgklrllyecnpvayi
ieqagglattgtqpvldvkpeaihqrvplilgspedvqeyltcvqkn

SCOPe Domain Coordinates for d5et8a_:

Click to download the PDB-style file with coordinates for d5et8a_.
(The format of our PDB-style files is described here.)

Timeline for d5et8a_:

  • d5et8a_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-23