Lineage for d5h4ha_ (5h4h A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2169006Fold c.120: PIN domain-like [88722] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145
  4. 2169007Superfamily c.120.1: PIN domain-like [88723] (3 families) (S)
  5. 2169008Family c.120.1.1: PIN domain [89619] (7 proteins)
    Pfam PF01850
  6. 2169046Protein Hypothetical protein PH0500 [142112] (2 species)
  7. 2169052Species Pyrococcus horikoshii [TaxId:70601] [326423] (2 PDB entries)
  8. 2169055Domain d5h4ha_: 5h4h A: [326438]
    automated match to d1v96a1
    complexed with cd

Details for d5h4ha_

PDB Entry: 5h4h (more details), 2.23 Å

PDB Description: structure of pin-domain protein (vapc4 toxin) from pyrococcus horikoshii determined at 2.2 a resolution
PDB Compounds: (A:) Ribonuclease VapC4

SCOPe Domain Sequences for d5h4ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h4ha_ c.120.1.1 (A:) Hypothetical protein PH0500 {Pyrococcus horikoshii [TaxId: 70601]}
plppditfdslalikmhsqnmkrilevtlakftvnlsivtvyryltaraylkknieaefe
ilkdiynivpllddiaikaaqieanlikkeitldmediitattaiytnsllvtddpkrye
pirrfgldtmpldkfikevelmve

SCOPe Domain Coordinates for d5h4ha_:

Click to download the PDB-style file with coordinates for d5h4ha_.
(The format of our PDB-style files is described here.)

Timeline for d5h4ha_: