Lineage for d5eqsa1 (5eqs A:1004-1179)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055629Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2055630Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2057706Family b.47.1.3: Viral proteases [50596] (5 protein domains)
    beta sheet in the first domain is opened rather than forms a barrel
  6. 2057796Protein automated matches [190658] (6 species)
    not a true protein
  7. 2057836Species Hepatitis C virus [TaxId:11103] [189262] (11 PDB entries)
  8. 2283132Domain d5eqsa1: 5eqs A:1004-1179 [326433]
    Other proteins in same PDB: d5eqsa2
    automated match to d5epna_
    complexed with 2r9, zn

Details for d5eqsa1

PDB Entry: 5eqs (more details), 1.84 Å

PDB Description: crystal structure of a genotype 1a/3a chimeric hcv ns3/4a protease in complex with asunaprevir
PDB Compounds: (A:) NS3 protease

SCOPe Domain Sequences for d5eqsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5eqsa1 b.47.1.3 (A:1004-1179) automated matches {Hepatitis C virus [TaxId: 11103]}
tayaqqtrgeegcqetsqtgrdknqvegevqivstatqtflatsingvlwtvyhgagtrt
iaspkgpvtqmytnvdkdlvgwqapqgsrsltpctcgssdlylvtrhadvipvrrrgdst
gsllsprplsylkgssggpllcpaghavgifraavctrgvakavqfipveslettm

SCOPe Domain Coordinates for d5eqsa1:

Click to download the PDB-style file with coordinates for d5eqsa1.
(The format of our PDB-style files is described here.)

Timeline for d5eqsa1:

  • d5eqsa1 appears in periodic updates to SCOPe 2.06 starting on 2016-11-23

View in 3D
Domains from same chain:
(mouse over for more information)
d5eqsa2