SCOPe 2.06: Domain d5gljc1: 5glj C:1086-1178

Lineage for d5gljc1 (5glj C:1086-1178)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (47 proteins)
   Pfam PF00595

6. Protein automated matches [190055] (7 species)
   not a true protein

7. Species Homo sapiens [TaxId:9606] [326414] (3 PDB entries)

8. Domain d5gljc1: 5glj C:1086-1178 [326431]
   Other proteins in same PDB: d5glja2, d5gljc2, d5gljd2
   automated match to d2h3lb_
   complexed with cl

Details for d5gljc1

PDB Entry: 5glj, 1.6 Å

PDB Description: crystal structure of pdz1 domain of human protein tyrosine phosphatase ptp-bas

PDB Compounds: (C:) Tyrosine-protein phosphatase non-receptor type 13

SCOPe Domain Sequences for d5gljc1:

Sequence; same for both SEQRES and ATOM records:

>d5gljc1 b.36.1.1 (C:1086-1178) automated matches {Homo sapiens [TaxId: 9606]}
spereitlvnlkkdakyglgfqiiggekmgrldlgifissvapggpadldgclkpgdrli
svnsvslegvshhaaieilqnapedvtlvisqp

Timeline for d5gljc1:

• d5gljc1 is new in SCOPe 2.06-stable
  
• d5gljc1 appears in SCOPe 2.07
  
• d5gljc1 appears in the current release, SCOPe 2.08