SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5fjtb1 (5fjt B:1-125)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2170927Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2170928Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2171206Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2171207Protein automated matches [226922] (85 species)
    not a true protein
  7. 2171242Species Amycolatopsis sp. [TaxId:37632] [226521] (6 PDB entries)
  8. 2283124Domain d5fjtb1: 5fjt B:1-125 [326425]
    Other proteins in same PDB: d5fjta2, d5fjtb2, d5fjtc2, d5fjtd2
    automated match to d1sjda2
    complexed with 5cr, mg; mutant

Details for d5fjtb1

PDB Entry: 5fjt (more details), 2.11 Å

PDB Description: n-acyl amino acid racemase from amycolatopsis sp. ts-1-60: g291d f323 mutant in complex with n-acetyl phenylalanine
PDB Compounds: (B:) o-succinylbenzoate synthase

SCOPe Domain Sequences for d5fjtb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fjtb1 d.54.1.0 (B:1-125) automated matches {Amycolatopsis sp. [TaxId: 37632]}
mklsgvelrrvqmplvapfrtsfgtqsvrellllravtpagegwgecvtmagplysseyn
dgaehvlrhylipallaaeditaakvtpllakfkghrmakgalemavldaelrahersfa
aelgs

SCOPe Domain Coordinates for d5fjtb1:

Click to download the PDB-style file with coordinates for d5fjtb1.
(The format of our PDB-style files is described here.)

Timeline for d5fjtb1:

  • d5fjtb1 appears in periodic updates to SCOPe 2.06 starting on 2016-11-23