SCOPe 2.06: Domain d5h4ga_: 5h4g A:

Lineage for d5h4ga_ (5h4g A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.120: PIN domain-like [88722] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.120.1: PIN domain-like [88723] (3 families)

5. Family c.120.1.1: PIN domain [89619] (7 proteins)
   Pfam PF01850

6. Protein Hypothetical protein PH0500 [142112] (2 species)

7. Species Pyrococcus horikoshii [TaxId:70601] [326423] (2 PDB entries)

8. Domain d5h4ga_: 5h4g A: [326424]
   automated match to d1v96a1
   complexed with zn

Details for d5h4ga_

PDB Entry: 5h4g, 1.77 Å

PDB Description: structure of pin-domain protein (vapc4 toxin) from pyrococcus horikoshii determined at 1.77 a resolution

PDB Compounds: (A:) Ribonuclease VapC4

SCOPe Domain Sequences for d5h4ga_:

Sequence, based on SEQRES records:

>d5h4ga_ c.120.1.1 (A:) Hypothetical protein PH0500 {Pyrococcus horikoshii [TaxId: 70601]}
plppditfdslalikmhsqnmkrilevtlakftvnlsivtvyryltaraylkknieaefe
ilkdiynivpllddiaikaaqieanlikkeitldmediitattaiytnsllvtddpkrye
pirrfgldtmpldkfikevelmvekel

Sequence, based on observed residues (ATOM records):

>d5h4ga_ c.120.1.1 (A:) Hypothetical protein PH0500 {Pyrococcus horikoshii [TaxId: 70601]}
plppditfdslalikmhsqnmkrilevtlakftvnlsivtvyryltarayknieaefeil
kdiynivpllddiaikaaqieanlikkeitldmediitattaiytnsllvtddpkryepi
rrfgldtmpldkfikevelmvekel

Timeline for d5h4ga_:

• d5h4ga_ is new in SCOPe 2.06-stable
  
• d5h4ga_ appears in SCOPe 2.07
  
• d5h4ga_ appears in the current release, SCOPe 2.08