SCOPe 2.08: Domain d5h5na_: 5h5n A:

Lineage for d5h5na_ (5h5n A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily)
   3 helices; irregular array

4. Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (4 families)

5. Family a.16.1.0: automated matches [326419] (1 protein)
   not a true family

6. Protein automated matches [326420] (1 species)
   not a true protein

7. Species Influenza A virus (a/little yellow-shouldered bat/guatemala/060/2010(h17n10)) [TaxId:1129347] [326421] (1 PDB entry)

8. Domain d5h5na_: 5h5n A: [326422]
   automated match to d2z0aa_

Details for d5h5na_

PDB Entry: 5h5n, 2 Å

PDB Description: the crystal structure of the ns1 (h17n10) rna-binding domain

PDB Compounds: (A:) Non-structural protein 1

SCOPe Domain Sequences for d5h5na_:

Sequence; same for both SEQRES and ATOM records:

>d5h5na_ a.16.1.0 (A:) automated matches {Influenza A virus (a/little yellow-shouldered bat/guatemala/060/2010(h17n10)) [TaxId: 1129347]}
epnpttiafqvdcylwhlkktlsmmgevdapfedrlrreqkalkgrsmtlgidiqsatqe
gyykiksitee

Timeline for d5h5na_:

• d5h5na_ first appeared in SCOPe 2.06
  
• d5h5na_ appears in SCOPe 2.07