Lineage for d1d1qa_ (1d1q A:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (2 superfamilies) Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (1 family) 
Family c.44.1.1: Low-molecular-weight phosphotyrosine protein phosphatases [52789] (1 protein) Protein Tyrosine phosphatase [52790] (3 species) Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52793] (3 PDB entries) 
Domain d1d1qa_: 1d1q A: [32642]
Details for d1d1qa_
PDB Entry: 1d1q (more details), 1.7 Å
PDB Description: crystal structure of a yeast low molecular weight protein tyrosine phosphatase (ltp1) complexed with the substrate pnpp
SCOP Domain Sequences for d1d1qa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d1qa_ c.44.1.1 (A:) Tyrosine phosphatase {Baker's yeast (Saccharomyces cerevisiae)}
iekpkisvafialgnfcrspmaeaifkhevekanlenrfnkidsfgtsnyhvgespdhrt
vsickqhgvkinhkgkqiktkhfdeydyiigmdesninnlkkiqpegskakvclfgdwnt
ndgtvqtiiedpwygdiqdfeynfkqityfskqflkkel
SCOP Domain Coordinates for d1d1qa_:
Click to download the PDB-style file with coordinates for d1d1qa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1d1qa_:
- d1d1qa_ appears in SCOP 1.57
- d1d1qa_ appears in the current release, SCOPe 2.08
View in 3D
