SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ft8i_ (5ft8 I:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2132229Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2132230Protein automated matches [190151] (111 species)
    not a true protein
  7. 2132475Species Escherichia coli K-12 [TaxId:83333] [226746] (6 PDB entries)
  8. 2283116Domain d5ft8i_: 5ft8 I: [326417]
    Other proteins in same PDB: d5ft8b1, d5ft8b2, d5ft8d1, d5ft8d2, d5ft8f_, d5ft8h1, d5ft8h2, d5ft8j_, d5ft8l_, d5ft8n_
    automated match to d4lw2a_
    complexed with css, gol, peg, plp

Details for d5ft8i_

PDB Entry: 5ft8 (more details), 2.5 Å

PDB Description: structure of a cysteine desulfurase-sulfur acceptor complex from escherichia coli at 2.50 angstroem resolution
PDB Compounds: (I:) cysteine desulfurase csda

SCOPe Domain Sequences for d5ft8i_:

Sequence, based on SEQRES records: (download)

>d5ft8i_ c.67.1.0 (I:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
mnvfnpaqfraqfpalqdagvyldsaatalkpeavveatqqfyslsagnvhrsqfaeaqr
ltaryeaarekvaqllnapddktivwtrgttesinmvaqcyarprlqpgdeiivsvaehh
anlvpwlmvaqqtgakvvklplnaqrlpdvdllpelitprsrilalgqmsnvtggcpdla
raitfahsagmvvmvdgaqgavhfpadvqqldidfyafsghklygptgigvlygkselle
amspwlgggkmvhevsfdgfttqsapwkleagtpnvagviglsaalewladydinqaesw
srslatlaedalakrpgfrsfrcqdssllafdfagvhhsdmvtllaeygialragqhcaq
pllaelgvtgtlrasfapyntksdvdalvnavdralellvd

Sequence, based on observed residues (ATOM records): (download)

>d5ft8i_ c.67.1.0 (I:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
mnvfnpaqfraqfpalqdagvyldsaatalkpeavveatqqfyslsagnvhrsqfaeaqr
ltaryeaarekvaqllnapddktivwtrgttesinmvaqcyarprlqpgdeiivsvaehh
anlvpwlmvaqqtgakvvklplnaqrlpdvdllpelitprsrilalgqmsnvtggcpdla
raitfahsagmvvmvdgaqgavhfpadvqqldidfyafsghklygptgigvlygkselle
amspwlgggkmvhevsfdgfttqsapwkleagtpnvagviglsaalewladydinqaesw
srslatlaedalakrpgfrsfrcqdssllafdfagvhhsdmvtllaeygialragqhaqp
llaelgvtgtlrasfapyntksdvdalvnavdralellvd

SCOPe Domain Coordinates for d5ft8i_:

Click to download the PDB-style file with coordinates for d5ft8i_.
(The format of our PDB-style files is described here.)

Timeline for d5ft8i_:

  • d5ft8i_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-23