Lineage for d5glja1 (5glj A:1086-1178)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2056344Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2056345Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2056346Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 2056646Protein automated matches [190055] (7 species)
    not a true protein
  7. 2056653Species Homo sapiens [TaxId:9606] [326414] (3 PDB entries)
  8. 2056654Domain d5glja1: 5glj A:1086-1178 [326415]
    Other proteins in same PDB: d5glja2, d5gljc2, d5gljd2
    automated match to d2h3lb_
    complexed with cl

Details for d5glja1

PDB Entry: 5glj (more details), 1.6 Å

PDB Description: crystal structure of pdz1 domain of human protein tyrosine phosphatase ptp-bas
PDB Compounds: (A:) Tyrosine-protein phosphatase non-receptor type 13

SCOPe Domain Sequences for d5glja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5glja1 b.36.1.1 (A:1086-1178) automated matches {Homo sapiens [TaxId: 9606]}
spereitlvnlkkdakyglgfqiiggekmgrldlgifissvapggpadldgclkpgdrli
svnsvslegvshhaaieilqnapedvtlvisqp

SCOPe Domain Coordinates for d5glja1:

Click to download the PDB-style file with coordinates for d5glja1.
(The format of our PDB-style files is described here.)

Timeline for d5glja1: