SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5en4a_ (5en4 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2090553Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 protein domains)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 2091795Protein automated matches [190085] (51 species)
    not a true protein
  7. 2091971Species Human (Homo sapiens) [TaxId:9606] [186828] (18 PDB entries)
  8. 2283110Domain d5en4a_: 5en4 A: [326411]
    automated match to d1ydef_
    complexed with 5q6, na, nad

Details for d5en4a_

PDB Entry: 5en4 (more details), 1.52 Å

PDB Description: complex of 17-beta-hydroxysteroid dehydrogenase type 14 with inhibitor.
PDB Compounds: (A:) 17-beta-hydroxysteroid dehydrogenase 14

SCOPe Domain Sequences for d5en4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5en4a_ c.2.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gtryagkvvvvtgggrgigagivrafvnsgarvvicdkdesggraleqelpgavfilcdv
tqeddvktlvsetirrfgrldcvvnnaghhpppqrpeetsaqgfrqllelnllgtytltk
lalpylrksqgnvinisslvgaigqaqavpyvatkgavtamtkalaldespygvrvncis
pgniwtplweelaalmpdpratiregmlaqplgrmgqpaevgaaavflaseanfctgiel
lvtggaelgyg

SCOPe Domain Coordinates for d5en4a_:

Click to download the PDB-style file with coordinates for d5en4a_.
(The format of our PDB-style files is described here.)

Timeline for d5en4a_:

  • d5en4a_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-23