Lineage for d5ft8n_ (5ft8 N:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2213792Fold d.224: SufE/NifU [82648] (1 superfamily)
    alpha(2)-beta(3)-alpha(3); 2 layers alpha/beta, 3-stranded antiparallel beta-sheet; order 123
  4. 2213793Superfamily d.224.1: SufE/NifU [82649] (4 families) (S)
    iron-sulfur cluster assembly proteins
  5. 2213794Family d.224.1.1: SufE-like [82650] (3 protein domains)
    Fe-S metabolism associated domain
    automatically mapped to Pfam PF02657
  6. 2213802Protein automated matches [191012] (4 species)
    not a true protein
  7. 2283102Species Escherichia coli [TaxId:83333] [326403] (1 PDB entry)
  8. 2283106Domain d5ft8n_: 5ft8 N: [326407]
    Other proteins in same PDB: d5ft8a_, d5ft8b2, d5ft8c_, d5ft8d2, d5ft8e_, d5ft8g_, d5ft8h2, d5ft8i_, d5ft8k_, d5ft8m_, d5ft8o_
    automated match to d4lw4c_
    complexed with css, gol, peg, plp

Details for d5ft8n_

PDB Entry: 5ft8 (more details), 2.5 Å

PDB Description: structure of a cysteine desulfurase-sulfur acceptor complex from escherichia coli at 2.50 angstroem resolution
PDB Compounds: (N:) sulfur acceptor protein csde

SCOPe Domain Sequences for d5ft8n_:

Sequence, based on SEQRES records: (download)

>d5ft8n_ d.224.1.1 (N:) automated matches {Escherichia coli [TaxId: 83333]}
ghpfgttvtaetlrntfapltqwedkyrqlimlgkqlpalpdelkaqakeiagcenrvwl
gytvaengkmhffgdsegrivrgllavlltavegktaaelqaqsplalfdelglraqlsa
srsqglnalseaiiaatkqv

Sequence, based on observed residues (ATOM records): (download)

>d5ft8n_ d.224.1.1 (N:) automated matches {Escherichia coli [TaxId: 83333]}
ghpfgttvtaetlrntfapltqwedkyrqlimlgkqlpalpdelkaqakeiagenrvwlg
ytvaengkmhffgdsegrivrgllavlltavegktaaelqaqsplalfdelglraqlsas
rsqglnalseaiiaatkqv

SCOPe Domain Coordinates for d5ft8n_:

Click to download the PDB-style file with coordinates for d5ft8n_.
(The format of our PDB-style files is described here.)

Timeline for d5ft8n_:

  • d5ft8n_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-23