SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5epda_ (5epd A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080000Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2080511Family c.1.4.0: automated matches [191310] (1 protein)
    not a true family
  6. 2080512Protein automated matches [190048] (19 species)
    not a true protein
  7. 2080542Species Agrobacterium tumefaciens [TaxId:358] [197106] (5 PDB entries)
  8. 2283105Domain d5epda_: 5epd A: [326406]
    automated match to d1icpb_

Details for d5epda_

PDB Entry: 5epd (more details), 2.1 Å

PDB Description: crystal structure of glycerol trinitrate reductase xdpb from agrobacterium sp. r89-1 (apo form)
PDB Compounds: (A:) Glycerol trinitrate reductase

SCOPe Domain Sequences for d5epda_:

Sequence, based on SEQRES records: (download)

>d5epda_ c.1.4.0 (A:) automated matches {Agrobacterium tumefaciens [TaxId: 358]}
tlfqptslgaitlanrivmapltrnragagfvpgeltagyyaqrasagliiseatqisqq
gqgyqdtpgiytqaqidgwkkvtaavhkkggrivlqlwhvgrishvnlqpnggapvapsa
iraevktfvnngfvdvsepraleleelagivddfrkaaansieagfdgvevhgangylle
qfakdganmrtdtyggsvenrarlmlevtaavaqeigpertgirispvspangiscsdpq
tqydyivdkldalgiayihvvegatggprdvapfdygslrrrfsrtyianngfdlelats
hladgradliafgrpfianpdlverlqsgaplaevnaakifggsaagytdyprfsettsd
n

Sequence, based on observed residues (ATOM records): (download)

>d5epda_ c.1.4.0 (A:) automated matches {Agrobacterium tumefaciens [TaxId: 358]}
tlfqptslgaitlanrivmapltrnragagfvpgeltagyyaqrasagliiseatqisqq
gqgyqdtpgiytqaqidgwkkvtaavhkkggrivlqlwhvgrishvnlqpnggapvapsa
iraevktfvnngfvdvsepraleleelagivddfrkaaansieagfdgvevhgangylle
qfakdganmrtdtyggsvenrarlmlevtaavaqeigpertgirispvspangiscsdpq
tqydyivdkldalgiayihvvepfdygslrrrfsrtyiandlelatshladgradliafg
rpfianpdlverlqsgaplaevnaakifggsaagytdyprfsettsdn

SCOPe Domain Coordinates for d5epda_:

Click to download the PDB-style file with coordinates for d5epda_.
(The format of our PDB-style files is described here.)

Timeline for d5epda_:

  • d5epda_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-23