Lineage for d5epda_ (5epd A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080000Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2080511Family c.1.4.0: automated matches [191310] (1 protein)
    not a true family
  6. 2080512Protein automated matches [190048] (20 species)
    not a true protein
  7. 2080542Species Agrobacterium tumefaciens [TaxId:358] [197106] (5 PDB entries)
  8. 2283105Domain d5epda_: 5epd A: [326406]
    automated match to d1icpb_

Details for d5epda_

PDB Entry: 5epd (more details), 2.1 Å

PDB Description: crystal structure of glycerol trinitrate reductase xdpb from agrobacterium sp. r89-1 (apo form)
PDB Compounds: (A:) Glycerol trinitrate reductase

SCOPe Domain Sequences for d5epda_:

Sequence, based on SEQRES records: (download)

>d5epda_ c.1.4.0 (A:) automated matches {Agrobacterium tumefaciens [TaxId: 358]}
tlfqptslgaitlanrivmapltrnragagfvpgeltagyyaqrasagliiseatqisqq
gqgyqdtpgiytqaqidgwkkvtaavhkkggrivlqlwhvgrishvnlqpnggapvapsa
iraevktfvnngfvdvsepraleleelagivddfrkaaansieagfdgvevhgangylle
qfakdganmrtdtyggsvenrarlmlevtaavaqeigpertgirispvspangiscsdpq
tqydyivdkldalgiayihvvegatggprdvapfdygslrrrfsrtyianngfdlelats
hladgradliafgrpfianpdlverlqsgaplaevnaakifggsaagytdyprfsettsd
n

Sequence, based on observed residues (ATOM records): (download)

>d5epda_ c.1.4.0 (A:) automated matches {Agrobacterium tumefaciens [TaxId: 358]}
tlfqptslgaitlanrivmapltrnragagfvpgeltagyyaqrasagliiseatqisqq
gqgyqdtpgiytqaqidgwkkvtaavhkkggrivlqlwhvgrishvnlqpnggapvapsa
iraevktfvnngfvdvsepraleleelagivddfrkaaansieagfdgvevhgangylle
qfakdganmrtdtyggsvenrarlmlevtaavaqeigpertgirispvspangiscsdpq
tqydyivdkldalgiayihvvepfdygslrrrfsrtyiandlelatshladgradliafg
rpfianpdlverlqsgaplaevnaakifggsaagytdyprfsettsdn

SCOPe Domain Coordinates for d5epda_:

Click to download the PDB-style file with coordinates for d5epda_.
(The format of our PDB-style files is described here.)

Timeline for d5epda_:

  • d5epda_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-23