SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ep8b1 (5ep8 B:1-70)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1997771Fold a.46: Methionine synthase domain-like [47643] (3 superfamilies)
    4 helices; bundle, left-handed twist; right-handed superhelix
  4. 1997782Superfamily a.46.2: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47648] (2 families) (S)
    automatically mapped to Pfam PF02885
  5. 1997842Family a.46.2.0: automated matches [254276] (1 protein)
    not a true family
  6. 1997843Protein automated matches [254641] (5 species)
    not a true protein
  7. 2283090Species Bacillus subtilis [TaxId:224308] [326391] (1 PDB entry)
  8. 2283096Domain d5ep8b1: 5ep8 B:1-70 [326397]
    Other proteins in same PDB: d5ep8a2, d5ep8a3, d5ep8b2, d5ep8b3
    automated match to d3h5qa1
    complexed with na, so4

Details for d5ep8b1

PDB Entry: 5ep8 (more details), 2.66 Å

PDB Description: x-ray structure of the complex pyrimidine-nucleoside phosphorylase from bacillus subtilis with sulfate ion
PDB Compounds: (B:) Pyrimidine-nucleoside phosphorylase

SCOPe Domain Sequences for d5ep8b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ep8b1 a.46.2.0 (B:1-70) automated matches {Bacillus subtilis [TaxId: 224308]}
mrmvdiiikkqngkeltteeiqffvngytdgsipdyqasalamaiffrdmsdreradltm
amvnsgetid

SCOPe Domain Coordinates for d5ep8b1:

Click to download the PDB-style file with coordinates for d5ep8b1.
(The format of our PDB-style files is described here.)

Timeline for d5ep8b1:

  • d5ep8b1 appears in periodic updates to SCOPe 2.06 starting on 2016-11-23