Lineage for d5eu9a1 (5eu9 A:2-140)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2554471Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2554472Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2554473Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 proteins)
    C-terminal domain is beta/alpha-barrel
  6. 2554524Protein Enolase [54828] (10 species)
  7. 2554568Species Human (Homo sapiens), gamma isoform [TaxId:9606] [110936] (15 PDB entries)
    Uniprot P09104
  8. 2554587Domain d5eu9a1: 5eu9 A:2-140 [326389]
    Other proteins in same PDB: d5eu9a2, d5eu9b2, d5eu9c2, d5eu9c3, d5eu9d2, d5eu9e2, d5eu9f2, d5eu9f3, d5eu9g2, d5eu9h2
    automated match to d2akza2
    complexed with 5tx, mg, pge

Details for d5eu9a1

PDB Entry: 5eu9 (more details), 2.05 Å

PDB Description: structure of human enolase 2 in complex with ((3s,5s)-1,5-dihydroxy-3- methyl-2-oxopyrrolidin-3-yl)phosphonic acid
PDB Compounds: (A:) Gamma-enolase

SCOPe Domain Sequences for d5eu9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5eu9a1 d.54.1.1 (A:2-140) Enolase {Human (Homo sapiens), gamma isoform [TaxId: 9606]}
siekiwareildsrgnptvevdlytakglfraavpsgastgiyealelrdgdkqrylgkg
vlkavdhinstiapalissglsvveqekldnlmleldgtenkskfganailgvslavcka
gaaerelplyrhiaqlagn

SCOPe Domain Coordinates for d5eu9a1:

Click to download the PDB-style file with coordinates for d5eu9a1.
(The format of our PDB-style files is described here.)

Timeline for d5eu9a1: