Lineage for d5b1jb2 (5b1j B:160-335)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2036241Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2036242Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2036937Family b.6.1.3: Multidomain cupredoxins [49550] (8 protein domains)
  6. 2037552Protein automated matches [226877] (4 species)
    not a true protein
  7. 2037612Species Alcaligenes xylosoxydans [TaxId:85698] [225578] (4 PDB entries)
  8. 2283086Domain d5b1jb2: 5b1j B:160-335 [326387]
    Other proteins in same PDB: d5b1jc_
    automated match to d1oe1a2
    complexed with cu

Details for d5b1jb2

PDB Entry: 5b1j (more details), 3 Å

PDB Description: crystal structure of the electron-transfer complex of copper nitrite reductase with a cupredoxin
PDB Compounds: (B:) Copper-containing nitrite reductase

SCOPe Domain Sequences for d5b1jb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b1jb2 b.6.1.3 (B:160-335) automated matches {Alcaligenes xylosoxydans [TaxId: 85698]}
qgkplhydraytigefdlyipkgpdgkykdyatlaesygdtvqvmrtltpshivfngkvg
altganaltakvgetvllihsqanrdtrphligghgdwvwetgkfanppqrdletwfirg
gsagaalytfkqpgvyaylnhnlieafelgaaghikvegkwnddlmkqikapapip

SCOPe Domain Coordinates for d5b1jb2:

Click to download the PDB-style file with coordinates for d5b1jb2.
(The format of our PDB-style files is described here.)

Timeline for d5b1jb2:

  • d5b1jb2 appears in periodic updates to SCOPe 2.06 starting on 2016-11-23