SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5b1jb1 (5b1j B:2-159)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2036241Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2036242Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2036937Family b.6.1.3: Multidomain cupredoxins [49550] (8 protein domains)
  6. 2037552Protein automated matches [226877] (4 species)
    not a true protein
  7. 2037612Species Alcaligenes xylosoxydans [TaxId:85698] [225578] (4 PDB entries)
  8. 2283085Domain d5b1jb1: 5b1j B:2-159 [326386]
    Other proteins in same PDB: d5b1jc_
    automated match to d1gs7a1
    complexed with cu

Details for d5b1jb1

PDB Entry: 5b1j (more details), 3 Å

PDB Description: crystal structure of the electron-transfer complex of copper nitrite reductase with a cupredoxin
PDB Compounds: (B:) Copper-containing nitrite reductase

SCOPe Domain Sequences for d5b1jb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b1jb1 b.6.1.3 (B:2-159) automated matches {Alcaligenes xylosoxydans [TaxId: 85698]}
dadklphtkvtlvappqvhpheqatksgpkvveftmtieekkmviddkgttlqamtfngs
mpgptlvvhegdyvqltlvnpatnamphnvdfhgatgalggakltnvnpgeqatlrfkad
rsgtfvyhcapegmvpwhvvsgmsgtlmvlprdglkdp

SCOPe Domain Coordinates for d5b1jb1:

Click to download the PDB-style file with coordinates for d5b1jb1.
(The format of our PDB-style files is described here.)

Timeline for d5b1jb1:

  • d5b1jb1 appears in periodic updates to SCOPe 2.06 starting on 2016-11-23