SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5eqra1 (5eqr A:1004-1179)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055629Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2055630Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2057706Family b.47.1.3: Viral proteases [50596] (5 protein domains)
    beta sheet in the first domain is opened rather than forms a barrel
  6. 2057796Protein automated matches [190658] (6 species)
    not a true protein
  7. 2057836Species Hepatitis C virus [TaxId:11103] [189262] (11 PDB entries)
  8. 2283083Domain d5eqra1: 5eqr A:1004-1179 [326384]
    Other proteins in same PDB: d5eqra2
    automated match to d5epna_
    complexed with so4, tsv, zn

Details for d5eqra1

PDB Entry: 5eqr (more details), 1.96 Å

PDB Description: crystal structure of a genotype 1a/3a chimeric hcv ns3/4a protease in complex with danoprevir
PDB Compounds: (A:) NS3 protease

SCOPe Domain Sequences for d5eqra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5eqra1 b.47.1.3 (A:1004-1179) automated matches {Hepatitis C virus [TaxId: 11103]}
tayaqqtrgeegcqetsqtgrdknqvegevqivstatqtflatsingvlwtvyhgagtrt
iaspkgpvtqmytnvdkdlvgwqapqgsrsltpctcgssdlylvtrhadvipvrrrgdst
gsllsprplsylkgssggpllcpaghavgifraavstrgvakavqfipveslettm

SCOPe Domain Coordinates for d5eqra1:

Click to download the PDB-style file with coordinates for d5eqra1.
(The format of our PDB-style files is described here.)

Timeline for d5eqra1:

  • d5eqra1 appears in periodic updates to SCOPe 2.06 starting on 2016-11-23

View in 3D
Domains from same chain:
(mouse over for more information)
d5eqra2