Lineage for d5b1ka2 (5b1k A:160-335)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2043106Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2043107Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2043852Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)
  6. 2044511Protein automated matches [226877] (4 species)
    not a true protein
  7. 2044571Species Alcaligenes xylosoxydans [TaxId:85698] [225578] (6 PDB entries)
  8. 2044573Domain d5b1ka2: 5b1k A:160-335 [326381]
    automated match to d1oe1a2
    complexed with cl, cu, pg4

Details for d5b1ka2

PDB Entry: 5b1k (more details), 1.35 Å

PDB Description: crystal structure of the chloride-bound form of blue copper nitrite reductase
PDB Compounds: (A:) Copper-containing nitrite reductase

SCOPe Domain Sequences for d5b1ka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b1ka2 b.6.1.3 (A:160-335) automated matches {Alcaligenes xylosoxydans [TaxId: 85698]}
qgkplhydraytigefdlyipkgpdgkykdyatlaesygdtvqvmrtltpshivfngkvg
altganaltakvgetvllihsqanrdtrphligghgdwvwetgkfanppqrdletwfirg
gsagaalytfkqpgvyaylnhnlieafelgaaghikvegkwnddlmkqikapapip

SCOPe Domain Coordinates for d5b1ka2:

Click to download the PDB-style file with coordinates for d5b1ka2.
(The format of our PDB-style files is described here.)

Timeline for d5b1ka2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5b1ka1