SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5b10o_ (5b10 O:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2068816Fold b.76: open-sided beta-meander [51086] (2 superfamilies)
    single sheet formed by beta-hairpin repeats; exposed on both sides in the middle
  4. 2068817Superfamily b.76.1: Outer surface protein [51087] (1 family) (S)
    21 stranded sheet partly folded upon itself at the ends
  5. 2068818Family b.76.1.1: Outer surface protein [51088] (3 protein domains)
  6. 2068830Protein automated matches [190440] (2 species)
    not a true protein
  7. 2283076Species Borrelia burgdorferi [TaxId:224326] [326377] (2 PDB entries)
  8. 2283077Domain d5b10o_: 5b10 O: [326378]
    automated match to d3aumo_
    mutant

Details for d5b10o_

PDB Entry: 5b10 (more details), 1.6 Å

PDB Description: a mutant of ospa
PDB Compounds: (O:) Outer surface protein A

SCOPe Domain Sequences for d5b10o_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b10o_ b.76.1.1 (O:) automated matches {Borrelia burgdorferi [TaxId: 224326]}
nsvsvdlpgsmkvlvskssnadgkydliatvdalelsgtsdknngsgvlegvkadaskvk
ltisddlgqttlevfksdgstlvskkvtskdkvladvkfnekgevsekiitradgtrley
tgiksdgsgkakevlkgyvlegtltaekttlvvkegtvtlsknisksgavsvelndtdss
aatkktaawnsgtstltitvnskktkdlvftssntitvqqydsngtslegsaveitklde
iknalk

SCOPe Domain Coordinates for d5b10o_:

Click to download the PDB-style file with coordinates for d5b10o_.
(The format of our PDB-style files is described here.)

Timeline for d5b10o_:

  • d5b10o_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-23