SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5tu0a_ (5tu0 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2144291Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2144292Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2145531Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2145532Protein automated matches [190039] (134 species)
    not a true protein
  7. 2145878Species Listeria monocytogenes [TaxId:169963] [193523] (5 PDB entries)
  8. 2283075Domain d5tu0a_: 5tu0 A: [326376]
    automated match to d2xd2a_
    complexed with mal, pge, ttn

Details for d5tu0a_

PDB Entry: 5tu0 (more details), 1.9 Å

PDB Description: 1.9 angstrom resolution crystal structure of maltose-binding periplasmic protein male from listeria monocytogenes in complex with maltose
PDB Compounds: (A:) Lmo2125 protein

SCOPe Domain Sequences for d5tu0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tu0a_ c.94.1.0 (A:) automated matches {Listeria monocytogenes [TaxId: 169963]}
sdektltvsvdagykdyvnkikgdfekdndvkvkvvekdmfetlealpldgpagtapdvm
msafdrigslgqqghlaevklgnkddydekdqkqvtiddkiygapaiietlvlyynkdll
dkapatfkdletlskdsrfaftsekgkntgflakwtdfyfsygllagyggyvfgdegtnp
kdiglnnkgsvegityatkwfqdvwpkgmqdnksaddfiqdqfvkgkaaailggpwsaan
ykeakinygvakiptlnngkeyspfaggkgwvvsnysknkdvaqkwldyvtnqknqetly
dmtnevpanlkardtakskndeltnavieqyknaqpmpnipemsevwtgaenlkfdaasg
sktpqpsaddavkviednvtqkytk

SCOPe Domain Coordinates for d5tu0a_:

Click to download the PDB-style file with coordinates for d5tu0a_.
(The format of our PDB-style files is described here.)

Timeline for d5tu0a_:

  • d5tu0a_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-17