Lineage for d5tu0a_ (5tu0 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2915150Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2915151Protein automated matches [190039] (161 species)
    not a true protein
  7. 2915680Species Listeria monocytogenes [TaxId:169963] [193523] (5 PDB entries)
  8. 2915686Domain d5tu0a_: 5tu0 A: [326376]
    automated match to d2xd2a_
    complexed with pge, ttn

Details for d5tu0a_

PDB Entry: 5tu0 (more details), 1.9 Å

PDB Description: 1.9 angstrom resolution crystal structure of maltose-binding periplasmic protein male from listeria monocytogenes in complex with maltose
PDB Compounds: (A:) Lmo2125 protein

SCOPe Domain Sequences for d5tu0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tu0a_ c.94.1.0 (A:) automated matches {Listeria monocytogenes [TaxId: 169963]}
sdektltvsvdagykdyvnkikgdfekdndvkvkvvekdmfetlealpldgpagtapdvm
msafdrigslgqqghlaevklgnkddydekdqkqvtiddkiygapaiietlvlyynkdll
dkapatfkdletlskdsrfaftsekgkntgflakwtdfyfsygllagyggyvfgdegtnp
kdiglnnkgsvegityatkwfqdvwpkgmqdnksaddfiqdqfvkgkaaailggpwsaan
ykeakinygvakiptlnngkeyspfaggkgwvvsnysknkdvaqkwldyvtnqknqetly
dmtnevpanlkardtakskndeltnavieqyknaqpmpnipemsevwtgaenlkfdaasg
sktpqpsaddavkviednvtqkytk

SCOPe Domain Coordinates for d5tu0a_:

Click to download the PDB-style file with coordinates for d5tu0a_.
(The format of our PDB-style files is described here.)

Timeline for d5tu0a_: