SCOPe 2.08: Domain d5tf1l1: 5tf1 L:1-102

Lineage for d5tf1l1 (5tf1 L:1-102)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)

8. Domain d5tf1l1: 5tf1 L:1-102 [326369]
   Other proteins in same PDB: d5tf1l2
   automated match to d1dn0a1

Details for d5tf1l1

PDB Entry: 5tf1, 1.86 Å

PDB Description: structure of chimeric 02-cc fab, a vrc01-like germline antibody

PDB Compounds: (L:) O2-CC Fab Light Chain

SCOPe Domain Sequences for d5tf1l1:

Sequence; same for both SEQRES and ATOM records:

>d5tf1l1 b.1.1.1 (L:1-102) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivltqspatlslspgeratlscrasqsvssylawyqqkpgqaprlliydasnratgipa
rfsgsgsgtdftltisslepedfavyycqqyeffgqgtklei

Timeline for d5tf1l1:

• d5tf1l1 first appeared in SCOPe 2.06
  
• d5tf1l1 appears in SCOPe 2.07