SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5elnd2 (5eln D:195-545)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2186950Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 2186951Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 2187333Family d.104.1.0: automated matches [227172] (1 protein)
    not a true family
  6. 2187334Protein automated matches [226887] (10 species)
    not a true protein
  7. 2282895Species Cryptosporidium parvum [TaxId:353152] [326196] (2 PDB entries)
  8. 2283057Domain d5elnd2: 5eln D:195-545 [326358]
    Other proteins in same PDB: d5elna1, d5elna3, d5elnb1, d5elnb3, d5elnc1, d5elnc3, d5elnd1, d5elnd3
    automated match to d3bjuc2
    protein/RNA complex; complexed with edo, gol, lys

Details for d5elnd2

PDB Entry: 5eln (more details), 1.9 Å

PDB Description: crystal structure of lysyl-trna synthetase from cryptosporidium parvum complexed with l-lysine
PDB Compounds: (D:) Lysine--tRNA ligase

SCOPe Domain Sequences for d5elnd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5elnd2 d.104.1.0 (D:195-545) automated matches {Cryptosporidium parvum [TaxId: 353152]}
qevryrqryldlmlneesrkvfklrsraikyirnyfdrlgflevetpmlnmiyggaaarp
fityhneletqlymriapelylkqlivggldkvyeigknfrnegidlthnpeftamefym
ayadyydlmdlteelisglvleihgslkipyhpdgpegkcieidfttpwkrfsfveeies
glgeklkrpldsqenidfmvemcekheielphprtaaklldklaghfvetkctnpsfiid
hpqtmsplakwhrekpemterfelfvlgkelcnaytelneplqqrkffeqqadakasgdv
eacpidetfclalehglpptggwglgidrlimfladknnikevilfpamrn

SCOPe Domain Coordinates for d5elnd2:

Click to download the PDB-style file with coordinates for d5elnd2.
(The format of our PDB-style files is described here.)

Timeline for d5elnd2:

  • d5elnd2 appears in periodic updates to SCOPe 2.06 starting on 2016-11-17