SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5emzf_ (5emz F:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2158219Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2158220Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2158221Family d.15.1.1: Ubiquitin-related [54237] (39 protein domains)
    Pfam PF00240
  6. 2158454Protein Ubiquitin [54238] (7 species)
  7. 2158532Species Human (Homo sapiens) [TaxId:9606] [54239] (170 PDB entries)
    Uniprot P62988
    identical sequence in many other species
  8. 2283055Domain d5emzf_: 5emz F: [326356]
    automated match to d2k39a_
    complexed with so4; mutant

Details for d5emzf_

PDB Entry: 5emz (more details), 1.66 Å

PDB Description: crystal structure of k48-linked diubiquitin with f45w mutation in the proximal unit
PDB Compounds: (F:) Polyubiquitin-B

SCOPe Domain Sequences for d5emzf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5emzf_ d.15.1.1 (F:) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]}
mqifvktltgktitlevepsdtienvkakiqdkegippdqqrliwagkqledgrtlsdyn
iqkestlhlvlrl

SCOPe Domain Coordinates for d5emzf_:

Click to download the PDB-style file with coordinates for d5emzf_.
(The format of our PDB-style files is described here.)

Timeline for d5emzf_:

  • d5emzf_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-17