Lineage for d5tvga1 (5tvg A:1-463)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2142044Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 2142045Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) (S)
  5. 2142537Family c.87.1.0: automated matches [191559] (1 protein)
    not a true family
  6. 2142538Protein automated matches [190965] (26 species)
    not a true protein
  7. 2283015Species Burkholderia vietnamiensis [TaxId:269482] [326316] (1 PDB entry)
  8. 2283050Domain d5tvga1: 5tvg A:1-463 [326351]
    Other proteins in same PDB: d5tvga2, d5tvgb2, d5tvgd2
    automated match to d5hxaa_
    complexed with gol, mg, udp

Details for d5tvga1

PDB Entry: 5tvg (more details), 2.3 Å

PDB Description: crystal structure of an alpha,alpha-trehalose-phosphate synthase (udp- forming) from burkholderia vietnamiensis
PDB Compounds: (A:) Alpha,alpha-trehalose-phosphate synthase (UDP-forming)

SCOPe Domain Sequences for d5tvga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tvga1 c.87.1.0 (A:1-463) automated matches {Burkholderia vietnamiensis [TaxId: 269482]}
msrlivvsnrvaagedtrpsagglavgvmdalkqtggvwfgwngeivgtpdaapavrrdg
nvtyatlgltrrdydqyyrgfsnatlwpvfhyrsdlarfdrqeyagylrvnamlarqlaa
llrpddliwvhdyhllpfahclrelgvknpigfflhipfpspdmlrvvpphdelvkfmca
ydiagfqtdadkrafsdyierrgigtasddgmlhahgrvvkvaaypigvypdaiaeaavq
yggrkpvkmlrdalggrklvmsvdrldyskglverfqsfermlagapdwqgrvsfvqiap
ptrsdvqtyqriretlereagringrfaqldwtpiqylnrkyernllmaffrmsqvgyvt
plrdgmnlvakeyvasqdpadpgvlvlsefagaaaelggallvnpydhaqmadalarala
mplaerqarheenlaqlrnndlsvwrdtfvadlrsvaaaasvt

SCOPe Domain Coordinates for d5tvga1:

Click to download the PDB-style file with coordinates for d5tvga1.
(The format of our PDB-style files is described here.)

Timeline for d5tvga1:

  • d5tvga1 appears in periodic updates to SCOPe 2.06 starting on 2016-11-17