Lineage for d5elob1 (5elo B:46-192)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2049950Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2051128Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 2052191Family b.40.4.0: automated matches [191416] (1 protein)
    not a true family
  6. 2052192Protein automated matches [190576] (33 species)
    not a true protein
  7. 2282892Species Cryptosporidium parvum [TaxId:353152] [326193] (2 PDB entries)
  8. 2283047Domain d5elob1: 5elo B:46-192 [326348]
    Other proteins in same PDB: d5eloa2, d5eloa3, d5elob2, d5elob3, d5eloc2, d5eloc3, d5elod2, d5elod3
    automated match to d3bjud1
    protein/RNA complex; complexed with edo, krs, lys, so4

Details for d5elob1

PDB Entry: 5elo (more details), 1.9 Å

PDB Description: crystal structure of lysyl-trna synthetase from cryptosporidium parvum complexed with l-lysine and cladosporin
PDB Compounds: (B:) Lysine--tRNA ligase

SCOPe Domain Sequences for d5elob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5elob1 b.40.4.0 (B:46-192) automated matches {Cryptosporidium parvum [TaxId: 353152]}
hytdnrykmmecikdagrpfyphkfkismslpayalkygnvengyidkdttlslsgrvts
irssssklifydifceeqkvqiianimehdistgefsvshseirrgdvvgftgfpgkskr
gelslfsksvvllspcyhmlptaisgl

SCOPe Domain Coordinates for d5elob1:

Click to download the PDB-style file with coordinates for d5elob1.
(The format of our PDB-style files is described here.)

Timeline for d5elob1:

  • d5elob1 appears in periodic updates to SCOPe 2.06 starting on 2016-11-17