Lineage for d5eebb_ (5eeb B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140671Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2140672Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2141090Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 2141091Protein automated matches [190683] (49 species)
    not a true protein
  7. 2141521Species Pyrobaculum sp. [TaxId:1104324] [228031] (9 PDB entries)
  8. 2283045Domain d5eebb_: 5eeb B: [326346]
    automated match to d4nmkc_

Details for d5eebb_

PDB Entry: 5eeb (more details), 3.04 Å

PDB Description: apo form of thermostable aldehyde dehydrogenase from pyrobaculum sp. 1860
PDB Compounds: (B:) aldehyde dehydrogenase

SCOPe Domain Sequences for d5eebb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5eebb_ c.82.1.0 (B:) automated matches {Pyrobaculum sp. [TaxId: 1104324]}
mkvanyingefkepstgafqvktspvdgskiaevprsgredareaidsafealkawanip
airraeylykmlevfrqmkedfmkiltvegggtyrkvwgevvfterliqnaaelarhyqg
rvlqsdsestisvvfkrskgvvgvitpwnyplsismkkiahtlavgntvvykpasdtpvt
gwliaqmvakaglpkgvfnlvigpgpvvgeeivthkrvahvtftgesstgreiaakaagt
lktvtlelggsdpliilddvdvdyaarlavfaslfhqgqictsakriivhkavadkfier
yvhyvkmlriddprkdekvdlgplinerqvalmkefvddavsrggrlliggrswgnffep
aifvdvdrnfrimreevfgpvrpivvvenddqavevandtdyglsgavltnnvnrafria
eavesgmfhindvtfleeshvpfggikasgvgreggewsfhettydrwvtvtlrtrrfpi
psal

SCOPe Domain Coordinates for d5eebb_:

Click to download the PDB-style file with coordinates for d5eebb_.
(The format of our PDB-style files is described here.)

Timeline for d5eebb_:

  • d5eebb_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-17