SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5hfjc_ (5hfj C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2130608Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2130609Protein automated matches [190689] (63 species)
    not a true protein
  7. 2130724Species Helicobacter pylori [TaxId:85962] [225261] (4 PDB entries)
  8. 2283039Domain d5hfjc_: 5hfj C: [326340]
    automated match to d1g60a_
    protein/DNA complex; complexed with sam

Details for d5hfjc_

PDB Entry: 5hfj (more details), 3.1 Å

PDB Description: crystal structure of m1.hpyavi-sam complex
PDB Compounds: (C:) Adenine specific DNA methyltransferase (DpnA)

SCOPe Domain Sequences for d5hfjc_:

Sequence, based on SEQRES records: (download)

>d5hfjc_ c.66.1.0 (C:) automated matches {Helicobacter pylori [TaxId: 85962]}
miqiyhadafeiikdfyqqnlkvdaiitdppynisvknnfptlksakrqgidfgewdknf
kllewiaryaplvnpngcmvifcsyrfisyiadfleengfvvkdfiqwvknnpmprnihr
ryvqdtefalwavkkkakwvfnkpknekylrplilkspvvsglektkhptqkslalmeki
isihtnpndivldpfmgsgttglacknlernfigiesekeyfqtakkrlnl

Sequence, based on observed residues (ATOM records): (download)

>d5hfjc_ c.66.1.0 (C:) automated matches {Helicobacter pylori [TaxId: 85962]}
miqiyhadafeiikdfyqqnlkvdaiitdppdknfkllewiaryaplvnpngcmvifcsy
rfisyiadfleengfvvkdfiqwvknnpmprnihrryvqdtefalwavkkkakwvfnkpk
nekylrplilkspsglektkhptqkslalmekiisihtnpndivldpfmgsgttglackn
lernfigiesekeyfqtakkrlnl

SCOPe Domain Coordinates for d5hfjc_:

Click to download the PDB-style file with coordinates for d5hfjc_.
(The format of our PDB-style files is described here.)

Timeline for d5hfjc_:

  • d5hfjc_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-17