SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5trtd_ (5trt D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2090553Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 protein domains)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 2091795Protein automated matches [190085] (51 species)
    not a true protein
  7. 2091862Species Burkholderia pseudomallei [TaxId:320372] [188614] (3 PDB entries)
  8. 2283031Domain d5trtd_: 5trt D: [326332]
    automated match to d4rlhb_
    complexed with edo, nad

Details for d5trtd_

PDB Entry: 5trt (more details), 1.85 Å

PDB Description: crystal structure of enoyl-(acyl carrier protein) reductase from burkholderia pseudomallei 1710b bound to nad
PDB Compounds: (D:) Enoyl-[acyl-carrier-protein] reductase [NADH]

SCOPe Domain Sequences for d5trtd_:

Sequence, based on SEQRES records: (download)

>d5trtd_ c.2.1.2 (D:) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
mgfldgkrilltgllsnrsiaygiakackregaelaftyvgdrfkdritefaaefgselv
fpcdvaddaqidalfaslkthwdsldglvhsigfapreaiagdfldgltrenfriahdis
aysfpalakaalpmlsddaslltlsylgaeraipnyntmglakaaleasvrylavslgak
gvrvnaisagpiktlaasgiksfgkildfvesnsplkrnvtieqvgnagafllsdlasgv
taevmhvdsgfnavvggma

Sequence, based on observed residues (ATOM records): (download)

>d5trtd_ c.2.1.2 (D:) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
mgfldgkrilltgllsnrsiaygiakackregaelaftyvgdrfkdritefaaefgselv
fpcdvaddaqidalfaslkthwdsldglvhsigfapreaiagdfldgltrenfriahdis
aysfpalakaalpmlsddaslltlsylgaeraipnyntmglakaaleasvrylavslgak
gvrvnaisagpiktiksfgkildfvesnsplkrnvtieqvgnagafllsdlasgvtaevm
hvdsgfnavvggma

SCOPe Domain Coordinates for d5trtd_:

Click to download the PDB-style file with coordinates for d5trtd_.
(The format of our PDB-style files is described here.)

Timeline for d5trtd_:

  • d5trtd_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-17